PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000556.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 258aa    MW: 29448.9 Da    PI: 7.0826
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000556.1_g00013.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR189.73.9e-2891178291
                     FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnH 87 
                              fYn+YA++vGF +r+sk ++s+++g+ + r +vC+keg+r  ++++  k  r+raetr+gC+a++ v+k ++gkw vtk+++eH+H
  Itr_sc000556.1_g00013.1  91 FYNAYATRVGFIIRVSKLSRSRKDGSAIGRALVCNKEGFRMADRRE--KVVRQRAETRVGCRAMILVRKVSSGKWIVTKFVKEHTH 174
                              ******************************************9988..999*********************************** PP

                     FAR1  88 elap 91 
                              +l+p
  Itr_sc000556.1_g00013.1 175 PLTP 178
                              *986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.8E-2591178IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MVPRVDFEID GDLNGEVVGS SVIEVRADAE NAIEGSPDEH DFHQAPNVKV DHDLSGRDVV  60
SIEEPETVSN SAPDEPYVGQ EFESEAAAHA FYNAYATRVG FIIRVSKLSR SRKDGSAIGR  120
ALVCNKEGFR MADRREKVVR QRAETRVGCR AMILVRKVSS GKWIVTKFVK EHTHPLTPGK  180
GRRESIYDQF PNEHDKIREL SQQLAAEKKR SATYKRHLEM IFEHIEEHNQ SLSKKIQDIV  240
NNVREMESRD QQNQQNRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605656.11e-140PREDICTED: protein FAR1-RELATED SEQUENCE 5 isoform X1
RefseqXP_016478794.11e-140PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
TrEMBLA0A0V0HLI01e-138A0A0V0HLI0_SOLCH; Uncharacterized protein
STRINGPGSC0003DMT4000694951e-137(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA115682325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.26e-97FAR1 family protein